SCOPe 2.03: Domain d1gioa_: 1gio A:

Lineage for d1gioa_ (1gio A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Angiogenin [54094] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries)

8. Domain d1gioa_: 1gio A: [37304]

Details for d1gioa_

PDB Entry: 1gio

PDB Description: nmr solution structure of bovine angiogenin, 10 structures

PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d1gioa_:

Sequence; same for both SEQRES and ATOM records:

>d1gioa_ d.5.1.1 (A:) Angiogenin {Cow (Bos taurus) [TaxId: 9913]}
aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
itprh

Timeline for d1gioa_:

• d1gioa_ first appeared (with stable ids) in SCOP 1.55, called d1gio__
  
• d1gioa_ appears in SCOPe 2.02
  
• d1gioa_ appears in SCOPe 2.04
  
• d1gioa_ appears in the current release, SCOPe 2.08