![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) |
![]() | Superfamily d.5.1: RNase A-like [54076] (1 family) ![]() |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Angiogenin [54094] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries) |
![]() | Domain d1gio__: 1gio - [37304] |
PDB Entry: 1gio (more details)
SCOP Domain Sequences for d1gio__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gio__ d.5.1.1 (-) Angiogenin {Cow (Bos taurus)} aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf itprh
Timeline for d1gio__: