Lineage for d1gio__ (1gio -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77162Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 77163Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 77164Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 77165Protein Angiogenin [54094] (2 species)
  7. 77166Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries)
  8. 77168Domain d1gio__: 1gio - [37304]

Details for d1gio__

PDB Entry: 1gio (more details)

PDB Description: nmr solution structure of bovine angiogenin, 10 structures

SCOP Domain Sequences for d1gio__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gio__ d.5.1.1 (-) Angiogenin {Cow (Bos taurus)}
aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
itprh

SCOP Domain Coordinates for d1gio__:

Click to download the PDB-style file with coordinates for d1gio__.
(The format of our PDB-style files is described here.)

Timeline for d1gio__: