SCOPe 2.07: Domain d1agia_: 1agi A:

Lineage for d1agia_ (1agi A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Angiogenin [54094] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries)

8. Domain d1agia_: 1agi A: [37303]

Details for d1agia_

PDB Entry: 1agi, 1.5 Å

PDB Description: crystal structure of bovine angiogenin at 1.5 angstroms resolution

PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d1agia_:

Sequence; same for both SEQRES and ATOM records:

>d1agia_ d.5.1.1 (A:) Angiogenin {Cow (Bos taurus) [TaxId: 9913]}
aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
itprh

Timeline for d1agia_:

• d1agia_ first appeared (with stable ids) in SCOP 1.55, called d1agi__
  
• d1agia_ appears in SCOPe 2.06
  
• d1agia_ appears in the current release, SCOPe 2.08