Lineage for d1agia_ (1agi A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890078Protein Angiogenin [54094] (2 species)
  7. 1890079Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries)
  8. 1890080Domain d1agia_: 1agi A: [37303]

Details for d1agia_

PDB Entry: 1agi (more details), 1.5 Å

PDB Description: crystal structure of bovine angiogenin at 1.5 angstroms resolution
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d1agia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agia_ d.5.1.1 (A:) Angiogenin {Cow (Bos taurus) [TaxId: 9913]}
aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
itprh

SCOPe Domain Coordinates for d1agia_:

Click to download the PDB-style file with coordinates for d1agia_.
(The format of our PDB-style files is described here.)

Timeline for d1agia_: