Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Angiogenin [54094] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries) |
Domain d1agia_: 1agi A: [37303] |
PDB Entry: 1agi (more details), 1.5 Å
SCOPe Domain Sequences for d1agia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agia_ d.5.1.1 (A:) Angiogenin {Cow (Bos taurus) [TaxId: 9913]} aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf itprh
Timeline for d1agia_: