Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) |
Superfamily d.5.1: RNase A-like [54076] (1 family) |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Angiogenin [54094] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries) |
Domain d1agi__: 1agi - [37303] |
PDB Entry: 1agi (more details), 1.5 Å
SCOP Domain Sequences for d1agi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agi__ d.5.1.1 (-) Angiogenin {Cow (Bos taurus)} aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf itprh
Timeline for d1agi__: