Lineage for d1agi__ (1agi -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) 
Protein Angiogenin [54094] (2 species) Species Cow (Bos taurus) [TaxId:9913] [54096] (2 PDB entries) 
Domain d1agi__: 1agi - [37303]
Details for d1agi__
PDB Entry: 1agi (more details), 1.5 Å
PDB Description: crystal structure of bovine angiogenin at 1.5 angstroms resolution
SCOP Domain Sequences for d1agi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agi__ d.5.1.1 (-) Angiogenin {Cow (Bos taurus)}
aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
itprh
SCOP Domain Coordinates for d1agi__:
Click to download the PDB-style file with coordinates for d1agi__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1agi__:
- d1agi__ appears in SCOP 1.57
- d1agi__ appears in the current release, SCOPe 2.08, called d1agia_
View in 3D