Lineage for d6pzna1 (6pzn A:1-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845814Species Acinetobacter baumannii [TaxId:470] [365483] (9 PDB entries)
  8. 2845842Domain d6pzna1: 6pzn A:1-244 [373016]
    Other proteins in same PDB: d6pzna2, d6pznc2
    automated match to d2c07a1

Details for d6pzna1

PDB Entry: 6pzn (more details), 2 Å

PDB Description: putative sdr from acinetobacter baumannii crystal form 2
PDB Compounds: (A:) 3-ketoacyl-ACP reductase

SCOPe Domain Sequences for d6pzna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pzna1 c.2.1.0 (A:1-244) automated matches {Acinetobacter baumannii [TaxId: 470]}
mnisrktalvtgasrgigraiaerlaqdgfyvivnyagnkahaqatvehiieqggqasai
qadvanehevsrlfqeakaingrldvvvhsagimpmakitpeslpdfdkvihtnlrgafl
ilahaaetvpdggriialstsviaksfpaygpyiaskagveglvhvlanelrgrnitvna
vapgptgtdlfyngktdeqvaaiaklaplerigtpdeiagvvamlagpdgrwvnsqvirv
nggf

SCOPe Domain Coordinates for d6pzna1:

Click to download the PDB-style file with coordinates for d6pzna1.
(The format of our PDB-style files is described here.)

Timeline for d6pzna1: