SCOPe 2.07: Domain d6kdzb1: 6kdz B:449-770

Lineage for d6kdzb1 (6kdz B:449-770)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d6kdzb1: 6kdz B:449-770 [373012]
   Other proteins in same PDB: d6kdza2, d6kdzb2
   automated match to d4ajmd_
   complexed with d79, mg, zn

Details for d6kdzb1

PDB Entry: 6kdz, 3.1 Å

PDB Description: crystal structure of pde10a in complex with a triazolopyrimidine inhibitor

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d6kdzb1:

Sequence; same for both SEQRES and ATOM records:

>d6kdzb1 a.211.1.0 (B:449-770) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgee

Timeline for d6kdzb1:

• d6kdzb1 is new in SCOPe 2.07-stable
  
• d6kdzb1 appears in the current release, SCOPe 2.08