SCOPe 2.08: Domain d6pe9f1: 6pe9 F:1-113

Lineage for d6pe9f1 (6pe9 F:1-113)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
Domain d6pe9f1: 6pe9 F:1-113 [373010]
Other proteins in same PDB: d6pe9b2, d6pe9d2, d6pe9f2, d6pe9l2, d6pe9m_
automated match to d4rgne1
complexed with so4

Details for d6pe9f1

PDB Entry: 6pe9 (more details), 3.13 Å

PDB Description: crystal structure of cd40 complexed to fab516

PDB Compounds: (F:) Fab light chain

SCOPe Domain Sequences for d6pe9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pe9f1 b.1.1.1 (F:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsllnlgnqknyltwfqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqndytypltfgqgtkleik

SCOPe Domain Coordinates for d6pe9f1:

Click to download the PDB-style file with coordinates for d6pe9f1.
(The format of our PDB-style files is described here.)

Timeline for d6pe9f1: