SCOPe 2.08: Domain d6k64c_: 6k64 C:

Lineage for d6k64c_ (6k64 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)

8. Domain d6k64c_: 6k64 C: [372975]
   Other proteins in same PDB: d6k64a_, d6k64b_
   automated match to d1bdca_

Details for d6k64c_

PDB Entry: 6k64, 1.93 Å

PDB Description: application of anti-helix antibodies in protein structure determination (8188-3lrh)

PDB Compounds: (C:) Protein A

SCOPe Domain Sequences for d6k64c_:

Sequence; same for both SEQRES and ATOM records:

>d6k64c_ a.8.1.1 (C:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
nkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnkaqaslksf

Timeline for d6k64c_:

• d6k64c_ first appeared in SCOPe 2.07