Lineage for d6k3mh_ (6k3m H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2696965Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2696966Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)
  8. 2696968Domain d6k3mh_: 6k3m H: [372964]
    Other proteins in same PDB: d6k3ma_
    automated match to d1bdca_

Details for d6k3mh_

PDB Entry: 6k3m (more details), 1.8 Å

PDB Description: application of anti-helix antibodies in protein structure determination (8189-3lrh)
PDB Compounds: (H:) SpA IgG-binding domain protein,Protein A

SCOPe Domain Sequences for d6k3mh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k3mh_ a.8.1.1 (H:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
fnkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnklqkafeslksf
q

SCOPe Domain Coordinates for d6k3mh_:

Click to download the PDB-style file with coordinates for d6k3mh_.
(The format of our PDB-style files is described here.)

Timeline for d6k3mh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6k3ma_