| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) ![]() |
| Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
| Protein automated matches [191290] (5 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [189943] (19 PDB entries) |
| Domain d6k6bb1: 6k6b B:3-57 [372962] Other proteins in same PDB: d6k6ba_, d6k6bb2 automated match to d1zxga_ |
PDB Entry: 6k6b (more details), 2.06 Å
SCOPe Domain Sequences for d6k6bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k6bb1 a.8.1.1 (B:3-57) automated matches {Staphylococcus aureus [TaxId: 1280]}
klmkafqslaffeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqap
Timeline for d6k6bb1: