Lineage for d6k6bb1 (6k6b B:3-57)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310326Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2310327Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2310424Protein automated matches [191290] (5 species)
    not a true protein
  7. 2310432Species Staphylococcus aureus [TaxId:1280] [189943] (19 PDB entries)
  8. 2310446Domain d6k6bb1: 6k6b B:3-57 [372962]
    Other proteins in same PDB: d6k6ba_, d6k6bb2
    automated match to d1zxga_

Details for d6k6bb1

PDB Entry: 6k6b (more details), 2.06 Å

PDB Description: application of anti-helix antibodies in protein structure determination (8496-3lrh)
PDB Compounds: (B:) Protein A

SCOPe Domain Sequences for d6k6bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k6bb1 a.8.1.1 (B:3-57) automated matches {Staphylococcus aureus [TaxId: 1280]}
klmkafqslaffeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqap

SCOPe Domain Coordinates for d6k6bb1:

Click to download the PDB-style file with coordinates for d6k6bb1.
(The format of our PDB-style files is described here.)

Timeline for d6k6bb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6k6bb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6k6ba_