SCOP 1.61: Domain d1b1ia_: 1b1i A:

Lineage for d1b1ia_ (1b1i A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Angiogenin [54094] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54095] (15 PDB entries)

8. Domain d1b1ia_: 1b1i A: [37295]

Details for d1b1ia_

PDB Entry: 1b1i, 1.8 Å

PDB Description: crystal structure of human angiogenin

SCOP Domain Sequences for d1b1ia_:

Sequence; same for both SEQRES and ATOM records:

>d1b1ia_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens)}
ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
rrp

Timeline for d1b1ia_:

• d1b1ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1b1ia_ appears in SCOP 1.59
  
• d1b1ia_ appears in SCOP 1.63
  
• d1b1ia_ appears in the current release, SCOPe 2.08