SCOPe 2.07: Domain d6k6ab_: 6k6a B:

Lineage for d6k6ab_ (6k6a B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6k6ab_: 6k6a B: [372940]
   Other proteins in same PDB: d6k6ac1, d6k6ac2, d6k6ad_
   automated match to d5lbsm_

Details for d6k6ab_

PDB Entry: 6k6a, 1.94 Å

PDB Description: application of anti-helix antibodies in protein structure determination (8188cys-3lrhcys)

PDB Compounds: (B:) 3LRH intrabody

SCOPe Domain Sequences for d6k6ab_:

Sequence; same for both SEQRES and ATOM records:

>d6k6ab_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvltqspsvsaaprqrvtisvsgsnsnigsntvnwiqqlpgrapellmcdddllapgvsd
rfsgsrsgtsasltisglqsedeadyyaatwddslngwvfgggtkvtvl

Timeline for d6k6ab_:

• d6k6ab_ is new in SCOPe 2.07-stable
  
• d6k6ab_ appears in the current release, SCOPe 2.08