![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Ribonuclease 4 [54092] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries) |
![]() | Domain d2rnfb_: 2rnf B: [37294] complexed with um3 |
PDB Entry: 2rnf (more details), 2.4 Å
SCOPe Domain Sequences for d2rnfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rnfb_ d.5.1.1 (B:) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]} mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
Timeline for d2rnfb_: