Lineage for d2rnfb_ (2rnf B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29833Protein Ribonuclease 4 [54092] (1 species)
  7. 29834Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)
  8. 29838Domain d2rnfb_: 2rnf B: [37294]

Details for d2rnfb_

PDB Entry: 2rnf (more details), 2.4 Å

PDB Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)

SCOP Domain Sequences for d2rnfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnfb_ d.5.1.1 (B:) Ribonuclease 4 {Human (Homo sapiens)}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

SCOP Domain Coordinates for d2rnfb_:

Click to download the PDB-style file with coordinates for d2rnfb_.
(The format of our PDB-style files is described here.)

Timeline for d2rnfb_: