Lineage for d6h2yl1 (6h2y L:1-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 3072873Domain d6h2yl1: 6h2y L:1-109 [372935]
    Other proteins in same PDB: d6h2yl2
    automated match to d1lila1
    complexed with edo, p33, peg, pg4

Details for d6h2yl1

PDB Entry: 6h2y (more details), 2.65 Å

PDB Description: human fab 1e6 bound to fhbp variant 3 from neisseria meningitidis serogroup b
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6h2yl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h2yl1 b.1.1.0 (L:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppslsvapgktatltcggnniagktvhwyqqrpgqapvlvisydsdrpsgiper
fsgsnsantatltisrveagdeadyycqvwdrnsdhwvfgggtkltvlg

SCOPe Domain Coordinates for d6h2yl1:

Click to download the PDB-style file with coordinates for d6h2yl1.
(The format of our PDB-style files is described here.)

Timeline for d6h2yl1:

  • d6h2yl1 is new in SCOPe 2.07-stable