Lineage for d2rnfa_ (2rnf A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253232Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 253233Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 253234Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 253285Protein Ribonuclease 4 [54092] (1 species)
  7. 253286Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)
  8. 253289Domain d2rnfa_: 2rnf A: [37293]

Details for d2rnfa_

PDB Entry: 2rnf (more details), 2.4 Å

PDB Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)

SCOP Domain Sequences for d2rnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnfa_ d.5.1.1 (A:) Ribonuclease 4 {Human (Homo sapiens)}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

SCOP Domain Coordinates for d2rnfa_:

Click to download the PDB-style file with coordinates for d2rnfa_.
(The format of our PDB-style files is described here.)

Timeline for d2rnfa_: