Lineage for d2rnfa_ (2rnf A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130218Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 130219Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 130220Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 130258Protein Ribonuclease 4 [54092] (1 species)
  7. 130259Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)
  8. 130262Domain d2rnfa_: 2rnf A: [37293]

Details for d2rnfa_

PDB Entry: 2rnf (more details), 2.4 Å

PDB Description: x-ray crystal structure of human ribonuclease 4 in complex with d(up)

SCOP Domain Sequences for d2rnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnfa_ d.5.1.1 (A:) Ribonuclease 4 {Human (Homo sapiens)}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

SCOP Domain Coordinates for d2rnfa_:

Click to download the PDB-style file with coordinates for d2rnfa_.
(The format of our PDB-style files is described here.)

Timeline for d2rnfa_: