| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
| Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
| Protein Ribonuclease 4 [54092] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries) |
| Domain d2rnfa_: 2rnf A: [37293] complexed with um3 |
PDB Entry: 2rnf (more details), 2.4 Å
SCOPe Domain Sequences for d2rnfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rnfa_ d.5.1.1 (A:) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
Timeline for d2rnfa_: