SCOPe 2.07: Domain d6i5fb4: 6i5f B:567-799

Lineage for d6i5fb4 (6i5f B:567-799)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226067] (7 PDB entries)

8. Domain d6i5fb4: 6i5f B:567-799 [372920]
   Other proteins in same PDB: d6i5fa1, d6i5fa2, d6i5fa3, d6i5fb1, d6i5fb2, d6i5fb3
   automated match to d1wb9a2
   complexed with adp, gol, so4; mutant

Details for d6i5fb4

PDB Entry: 6i5f, 2.6 Å

PDB Description: crystal structure of dna-free e.coli muts p839e dimer mutant

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d6i5fb4:

Sequence, based on SEQRES records:

>d6i5fb4 c.37.1.0 (B:567-799) automated matches {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesi

Sequence, based on observed residues (ATOM records):

>d6i5fb4 c.37.1.0 (B:567-799) automated matches {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgrstfmvemtetanilhnateyslvlmde
igrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgd
tiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesi

Timeline for d6i5fb4:

• d6i5fb4 is new in SCOPe 2.07-stable
  
• d6i5fb4 appears in the current release, SCOPe 2.08