SCOPe 2.06: Domain d1rnfb1: 1rnf B:1-119

Lineage for d1rnfb1 (1rnf B:1-119)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease 4 [54092] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)

8. Domain d1rnfb1: 1rnf B:1-119 [37292]
   Other proteins in same PDB: d1rnfa2, d1rnfb2

Details for d1rnfb1

PDB Entry: 1rnf, 2.1 Å

PDB Description: x-ray crystal structure of unliganded human ribonuclease 4

PDB Compounds: (B:) protein (ribonuclease 4)

SCOPe Domain Sequences for d1rnfb1:

Sequence; same for both SEQRES and ATOM records:

>d1rnfb1 d.5.1.1 (B:1-119) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]}
qdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicstt
niqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

Timeline for d1rnfb1:

• d1rnfb1 first appeared (with stable ids) in SCOP 1.55, called d1rnfb_
  
• d1rnfb1 was called d1rnfb_ in SCOPe 2.05
  
• d1rnfb1 appears in SCOPe 2.07
  
• d1rnfb1 appears in the current release, SCOPe 2.08