Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Ribonuclease 4 [54092] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries) |
Domain d1rnfb1: 1rnf B:1-119 [37292] Other proteins in same PDB: d1rnfa2, d1rnfb2 |
PDB Entry: 1rnf (more details), 2.1 Å
SCOPe Domain Sequences for d1rnfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rnfb1 d.5.1.1 (B:1-119) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]} qdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicstt niqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
Timeline for d1rnfb1: