Lineage for d1rnfb_ (1rnf B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188484Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 188485Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 188486Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 188532Protein Ribonuclease 4 [54092] (1 species)
  7. 188533Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)
  8. 188535Domain d1rnfb_: 1rnf B: [37292]

Details for d1rnfb_

PDB Entry: 1rnf (more details), 2.1 Å

PDB Description: x-ray crystal structure of unliganded human ribonuclease 4

SCOP Domain Sequences for d1rnfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rnfb_ d.5.1.1 (B:) Ribonuclease 4 {Human (Homo sapiens)}
mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

SCOP Domain Coordinates for d1rnfb_:

Click to download the PDB-style file with coordinates for d1rnfb_.
(The format of our PDB-style files is described here.)

Timeline for d1rnfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rnfa_