Lineage for d1rnfb1 (1rnf B:1-119)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928139Protein Ribonuclease 4 [54092] (1 species)
  7. 2928140Species Human (Homo sapiens) [TaxId:9606] [54093] (2 PDB entries)
  8. 2928142Domain d1rnfb1: 1rnf B:1-119 [37292]
    Other proteins in same PDB: d1rnfa2, d1rnfb2

Details for d1rnfb1

PDB Entry: 1rnf (more details), 2.1 Å

PDB Description: x-ray crystal structure of unliganded human ribonuclease 4
PDB Compounds: (B:) protein (ribonuclease 4)

SCOPe Domain Sequences for d1rnfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rnfb1 d.5.1.1 (B:1-119) Ribonuclease 4 {Human (Homo sapiens) [TaxId: 9606]}
qdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicstt
niqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg

SCOPe Domain Coordinates for d1rnfb1:

Click to download the PDB-style file with coordinates for d1rnfb1.
(The format of our PDB-style files is described here.)

Timeline for d1rnfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rnfb2