Class a: All alpha proteins [46456] (289 folds) |
Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) |
Family a.113.1.0: automated matches [254202] (1 protein) not a true family |
Protein automated matches [254442] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [254939] (3 PDB entries) |
Domain d6i5fb3: 6i5f B:270-566 [372919] Other proteins in same PDB: d6i5fa1, d6i5fa2, d6i5fa4, d6i5fb1, d6i5fb2, d6i5fb4 automated match to d1wb9a1 complexed with adp, gol, so4; mutant |
PDB Entry: 6i5f (more details), 2.6 Å
SCOPe Domain Sequences for d6i5fb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i5fb3 a.113.1.0 (B:270-566) automated matches {Escherichia coli [TaxId: 562]} daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d6i5fb3:
View in 3D Domains from other chains: (mouse over for more information) d6i5fa1, d6i5fa2, d6i5fa3, d6i5fa4 |