Lineage for d6h9ec_ (6h9e C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857119Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2857120Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
  6. 2857124Protein Glutamate mutase, small subunit [52246] (2 species)
  7. 2857125Species Clostridium cochlearium [TaxId:1494] [52248] (6 PDB entries)
  8. 2857129Domain d6h9ec_: 6h9e C: [372905]
    Other proteins in same PDB: d6h9eb_, d6h9ed_
    automated match to d1i9ca_
    complexed with b12, fwk, gol, tar

Details for d6h9ec_

PDB Entry: 6h9e (more details), 1.82 Å

PDB Description: structure of glutamate mutase reconstituted with homo-coenzyme b12
PDB Compounds: (C:) Glutamate mutase sigma subunit

SCOPe Domain Sequences for d6h9ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h9ec_ c.23.6.1 (C:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]}
mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqenfikaaietkadailv
sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
tppevgiadlkkdlnie

SCOPe Domain Coordinates for d6h9ec_:

Click to download the PDB-style file with coordinates for d6h9ec_.
(The format of our PDB-style files is described here.)

Timeline for d6h9ec_: