Lineage for d6h4ga1 (6h4g A:216-354)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2817013Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries)
  8. 2817018Domain d6h4ga1: 6h4g A:216-354 [372893]
    automated match to d4jv4a1
    complexed with cmp, nos; mutant

Details for d6h4ga1

PDB Entry: 6h4g (more details), 2.14 Å

PDB Description: regulatory subunit of a camp-independent protein kinase a from trypanosoma brucei: e311a, t318r, v319a mutant bound to camp in the a site
PDB Compounds: (A:) Protein kinase A regulatory subunit

SCOPe Domain Sequences for d6h4ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h4ga1 b.82.3.0 (A:216-354) automated matches {Trypanosoma brucei [TaxId: 185431]}
aksyvapyfeksedetalilklltynvlfsfldsrdlmtvagamwrvefkqddcimeagq
ttcdklyiiqdgkadiikegqkvylkvegtavgelalmyqtpraatvkvctpeliawald
rdtyrhlvmgsairrrety

SCOPe Domain Coordinates for d6h4ga1:

Click to download the PDB-style file with coordinates for d6h4ga1.
(The format of our PDB-style files is described here.)

Timeline for d6h4ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h4ga2