| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
| Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
| Protein automated matches [226927] (20 species) not a true protein |
| Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries) |
| Domain d6h4ga1: 6h4g A:216-354 [372893] automated match to d4jv4a1 complexed with cmp, nos; mutant |
PDB Entry: 6h4g (more details), 2.14 Å
SCOPe Domain Sequences for d6h4ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h4ga1 b.82.3.0 (A:216-354) automated matches {Trypanosoma brucei [TaxId: 185431]}
aksyvapyfeksedetalilklltynvlfsfldsrdlmtvagamwrvefkqddcimeagq
ttcdklyiiqdgkadiikegqkvylkvegtavgelalmyqtpraatvkvctpeliawald
rdtyrhlvmgsairrrety
Timeline for d6h4ga1: