Lineage for d6h5ob3 (6h5o B:328-668)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013965Species Staphylococcus aureus [TaxId:158878] [256157] (6 PDB entries)
  8. 3013977Domain d6h5ob3: 6h5o B:328-668 [372891]
    Other proteins in same PDB: d6h5oa1, d6h5oa2, d6h5ob1, d6h5ob2
    automated match to d1vqqa3
    complexed with cd, jpp

Details for d6h5ob3

PDB Entry: 6h5o (more details), 2.82 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with piperacillin at active site.
PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d6h5ob3:

Sequence, based on SEQRES records: (download)

>d6h5ob3 e.3.1.1 (B:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Sequence, based on observed residues (ATOM records): (download)

>d6h5ob3 e.3.1.1 (B:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmrqigwfisydkdnpnmmmainv
kdvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d6h5ob3:

Click to download the PDB-style file with coordinates for d6h5ob3.
(The format of our PDB-style files is described here.)

Timeline for d6h5ob3: