SCOP 1.57: Domain d1dytb_: 1dyt B:

Lineage for d1dytb_ (1dyt B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54091] (2 PDB entries)

8. Domain d1dytb_: 1dyt B: [37289]

Details for d1dytb_

PDB Entry: 1dyt, 1.75 Å

PDB Description: x-ray crystal structure of ecp (rnase 3) at 1.75 a

SCOP Domain Sequences for d1dytb_:

Sequence; same for both SEQRES and ATOM records:

>d1dytb_ d.5.1.1 (B:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens)}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

Timeline for d1dytb_:

• d1dytb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dytb_ appears in SCOP 1.59
  
• d1dytb_ appears in the current release, SCOPe 2.08