Lineage for d1dytb_ (1dyt B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) 
Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54091] (2 PDB entries) 
Domain d1dytb_: 1dyt B: [37289]
Details for d1dytb_
PDB Entry: 1dyt (more details), 1.75 Å
PDB Description: x-ray crystal structure of ecp (rnase 3) at 1.75 a
SCOP Domain Sequences for d1dytb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dytb_ d.5.1.1 (B:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens)}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti
SCOP Domain Coordinates for d1dytb_:
Click to download the PDB-style file with coordinates for d1dytb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dytb_:
- d1dytb_ appears in SCOP 1.57
- d1dytb_ appears in the current release, SCOPe 2.08
View in 3D
