Lineage for d1dytb_ (1dyt B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928101Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species)
  7. 2928102Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries)
  8. 2928110Domain d1dytb_: 1dyt B: [37289]
    complexed with cit, fe

Details for d1dytb_

PDB Entry: 1dyt (more details), 1.75 Å

PDB Description: x-ray crystal structure of ecp (rnase 3) at 1.75 a
PDB Compounds: (B:) eosinophil cationic protein

SCOPe Domain Sequences for d1dytb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dytb_ d.5.1.1 (B:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

SCOPe Domain Coordinates for d1dytb_:

Click to download the PDB-style file with coordinates for d1dytb_.
(The format of our PDB-style files is described here.)

Timeline for d1dytb_: