Lineage for d6h9fb_ (6h9f B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448447Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2448483Family c.1.19.2: Glutamate mutase, large subunit [51707] (1 protein)
    automatically mapped to Pfam PF06368
  6. 2448484Protein Glutamate mutase, large subunit [51708] (1 species)
  7. 2448485Species Clostridium cochlearium [TaxId:1494] [51709] (5 PDB entries)
  8. 2448494Domain d6h9fb_: 6h9f B: [372888]
    Other proteins in same PDB: d6h9fa_, d6h9fc_
    automated match to d1ccwb_
    complexed with 8zb, b12, tar

Details for d6h9fb_

PDB Entry: 6h9f (more details), 2.1 Å

PDB Description: structure of glutamate mutase reconstituted with bishomo-coenzyme b12
PDB Compounds: (B:) Glutamate mutase epsilon subunit

SCOPe Domain Sequences for d6h9fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h9fb_ c.1.19.2 (B:) Glutamate mutase, large subunit {Clostridium cochlearium [TaxId: 1494]}
melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
llngfpgvnhgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
rpe

SCOPe Domain Coordinates for d6h9fb_:

Click to download the PDB-style file with coordinates for d6h9fb_.
(The format of our PDB-style files is described here.)

Timeline for d6h9fb_: