Lineage for d1dyta_ (1dyt A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29821Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species)
  7. 29822Species Human (Homo sapiens) [TaxId:9606] [54091] (2 PDB entries)
  8. 29823Domain d1dyta_: 1dyt A: [37288]

Details for d1dyta_

PDB Entry: 1dyt (more details), 1.75 Å

PDB Description: x-ray crystal structure of ecp (rnase 3) at 1.75 a

SCOP Domain Sequences for d1dyta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyta_ d.5.1.1 (A:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens)}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

SCOP Domain Coordinates for d1dyta_:

Click to download the PDB-style file with coordinates for d1dyta_.
(The format of our PDB-style files is described here.)

Timeline for d1dyta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dytb_