SCOPe 2.07: Domain d6h6me_: 6h6m E:

Lineage for d6h6me_ (6h6m E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6h6me_: 6h6m E: [372877]
   automated match to d5ffla_
   complexed with cho, edo, na, peg, pge

Details for d6h6me_

PDB Entry: 6h6m, 2.38 Å

PDB Description: cr10 murine norovirus protruding domain in complex with the cd300lf receptor and glycochenodeoxycholate (gcdca)

PDB Compounds: (E:) CMRF35-like molecule 1

SCOPe Domain Sequences for d6h6me_:

Sequence; same for both SEQRES and ATOM records:

>d6h6me_ b.1.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvp

Timeline for d6h6me_:

• d6h6me_ is new in SCOPe 2.07-stable
  
• d6h6me_ appears in the current release, SCOPe 2.08