Lineage for d6hjdd_ (6hjd D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. Species Vibrio cholerae [TaxId:666] [50209] (29 PDB entries)
    Uniprot P01556 22-124
  8. Domain d6hjdd_: 6hjd D: [372875]
    automated match to d1jr0d_
    complexed with bcn, ca, fuc

Details for d6hjdd_

PDB Entry: 6hjd (more details), 1.54 Å

PDB Description: cholera toxin classical b-pentamer in complex with lewis-x
PDB Compounds: (D:) cholera toxin b subunit

SCOPe Domain Sequences for d6hjdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hjdd_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d6hjdd_ are not available.

Timeline for d6hjdd_:

Domains from other chains:
(mouse over for more information)
d6hjda_, d6hjdb_, d6hjdc_, d6hjde_, d6hjdf_, d6hjdg_, d6hjdh_, d6hjdi_, d6hjdj_