![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein automated matches [190161] (29 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [256157] (6 PDB entries) |
![]() | Domain d6h5oa3: 6h5o A:328-668 [372863] Other proteins in same PDB: d6h5oa1, d6h5oa2, d6h5ob1, d6h5ob2 automated match to d1vqqa3 complexed with cd, jpp |
PDB Entry: 6h5o (more details), 2.82 Å
SCOPe Domain Sequences for d6h5oa3:
Sequence, based on SEQRES records: (download)
>d6h5oa3 e.3.1.1 (A:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]} idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm mmainvkdvqdkgmasynakisgkvydelyengnkkydide
>d6h5oa3 e.3.1.1 (A:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]} idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk kepllnkfqittspgstqkiltamiglnnkqaiessdniffarvalelgskkfekgmkkl gvgedipsdypfynaqisnknldneilladsgygqgeilinpvqilsiysalenngnina phllkdtknkvwkkniiskeninlltdgmqqvvnkthkediyrsyanligksgtaegetg rqigwfisydkdnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
Timeline for d6h5oa3: