SCOPe 2.07: Domain d6h5oa1: 6h5o A:27-138

Lineage for d6h5oa1 (6h5o A:27-138)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (33 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256155] (6 PDB entries)

8. Domain d6h5oa1: 6h5o A:27-138 [372861]
   Other proteins in same PDB: d6h5oa2, d6h5oa3, d6h5ob2, d6h5ob3
   automated match to d1vqqa1
   complexed with cd, jpp

Details for d6h5oa1

PDB Entry: 6h5o, 2.82 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with piperacillin at active site.

PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d6h5oa1:

Sequence; same for both SEQRES and ATOM records:

>d6h5oa1 d.17.4.0 (A:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d6h5oa1:

• d6h5oa1 is new in SCOPe 2.07-stable
  
• d6h5oa1 appears in the current release, SCOPe 2.08