Lineage for d1b6va_ (1b6v A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174603Protein Hybrid between ribonuclease A and seminal ribonuclease [54088] (1 species)
  7. 2174604Species Cow (Bos taurus) [TaxId:9913] [54089] (1 PDB entry)
  8. 2174605Domain d1b6va_: 1b6v A: [37286]

Details for d1b6va_

PDB Entry: 1b6v (more details), 2 Å

PDB Description: crystal structure of a hybrid between ribonuclease a and bovine seminal ribonuclease
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1b6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6va_ d.5.1.1 (A:) Hybrid between ribonuclease A and seminal ribonuclease {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqankhiivacggkpyvpvhf
dasv

SCOPe Domain Coordinates for d1b6va_:

Click to download the PDB-style file with coordinates for d1b6va_.
(The format of our PDB-style files is described here.)

Timeline for d1b6va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b6vb_