Lineage for d1b6va_ (1b6v A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77162Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 77163Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 77164Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 77195Protein Hybrid between ribonuclease A and seminal ribonuclease [54088] (1 species)
  7. 77196Species Cow (Bos taurus) [TaxId:9913] [54089] (1 PDB entry)
  8. 77197Domain d1b6va_: 1b6v A: [37286]

Details for d1b6va_

PDB Entry: 1b6v (more details), 2 Å

PDB Description: crystal structure of a hybrid between ribonuclease a and bovine seminal ribonuclease

SCOP Domain Sequences for d1b6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6va_ d.5.1.1 (A:) Hybrid between ribonuclease A and seminal ribonuclease {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqankhiivacggkpyvpvhf
dasv

SCOP Domain Coordinates for d1b6va_:

Click to download the PDB-style file with coordinates for d1b6va_.
(The format of our PDB-style files is described here.)

Timeline for d1b6va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b6vb_