Lineage for d6h4gb2 (6h4g B:355-490)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426259Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2426260Protein automated matches [226927] (18 species)
    not a true protein
  7. 2426370Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries)
  8. 2426378Domain d6h4gb2: 6h4g B:355-490 [372859]
    automated match to d4jv4a2
    complexed with cmp, nos; mutant

Details for d6h4gb2

PDB Entry: 6h4g (more details), 2.14 Å

PDB Description: regulatory subunit of a camp-independent protein kinase a from trypanosoma brucei: e311a, t318r, v319a mutant bound to camp in the a site
PDB Compounds: (B:) Protein kinase A regulatory subunit

SCOPe Domain Sequences for d6h4gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h4gb2 b.82.3.0 (B:355-490) automated matches {Trypanosoma brucei [TaxId: 185431]}
iqfltnipflsgldnyeklqladalssdefepgdyiirygeegewlyiilegsvdvvgrd
ddgnekhvwefgkgdhvgeleflnnhanvadvvakthvvtaklnrrhfemclgpvidvlk
rtsqqpnyeyyqsklk

SCOPe Domain Coordinates for d6h4gb2:

Click to download the PDB-style file with coordinates for d6h4gb2.
(The format of our PDB-style files is described here.)

Timeline for d6h4gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h4gb1