Lineage for d6ag4a_ (6ag4 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. Protein automated matches [190038] (49 species)
    not a true protein
  7. Species Sulfolobus solfataricus [TaxId:273057] [267809] (6 PDB entries)
  8. Domain d6ag4a_: 6ag4 A: [372849]
    automated match to d4lx9a_
    complexed with aco, ca, so4; mutant

Details for d6ag4a_

PDB Entry: 6ag4 (more details), 2.2600000000000002 Å

PDB Description: crystal structure of ard1 n-terminal acetyltransferase h88a/e127a mutant from sulfolobus solfataricus
PDB Compounds: (A:) N-alpha-acetyltransferase

SCOPe Domain Sequences for d6ag4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ag4a_ d.108.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
dftlrnarmddidqiikinrltlpenypyyffvehlkeyglaffvaivdnsvvgyimpri
ewgfsnikqlpslvrkgavvsiavleeyrrkgiattlleasmksmkndynaeeiylavrv
snypaialyeklnfkkvkvlkgyyadgedaylmarpl

SCOPe Domain Coordinates for d6ag4a_ are not available.

Timeline for d6ag4a_: