Lineage for d6h6mf_ (6h6m F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370757Domain d6h6mf_: 6h6m F: [372843]
    automated match to d5ffla_
    complexed with cho, edo, na, peg, pge

Details for d6h6mf_

PDB Entry: 6h6m (more details), 2.38 Å

PDB Description: cr10 murine norovirus protruding domain in complex with the cd300lf receptor and glycochenodeoxycholate (gcdca)
PDB Compounds: (F:) CMRF35-like molecule 1

SCOPe Domain Sequences for d6h6mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6mf_ b.1.1.0 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvp

SCOPe Domain Coordinates for d6h6mf_:

Click to download the PDB-style file with coordinates for d6h6mf_.
(The format of our PDB-style files is described here.)

Timeline for d6h6mf_: