![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Seminal ribonucleasease [54086] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries) Uniprot P00669 27-150 |
![]() | Domain d11baa_: 11ba A: [37284] protein/RNA complex; complexed with so4, upa |
PDB Entry: 11ba (more details), 2.06 Å
SCOPe Domain Sequences for d11baa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d11baa_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]} kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf dasv
Timeline for d11baa_: