Lineage for d6h6ub_ (6h6u B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein (Apo)ferritin [47246] (8 species)
  7. Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (45 PDB entries)
  8. Domain d6h6ub_: 6h6u B: [372839]
    automated match to d5up8a_
    complexed with ca, fe, gol

Details for d6h6ub_

PDB Entry: 6h6u (more details), 2 Å

PDB Description: unitary crystal structure of the positively supercharged variant ftn(pos) from human heavy chain ferritin (peg 400 condition)
PDB Compounds: (B:) ferritin heavy chain

SCOPe Domain Sequences for d6h6ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6ub_ a.25.1.1 (B:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
tsqvrqnyhqdsekainrqirlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdkddwesglramekalklekkvnqsllelhklatkk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgaprsglaeylfdkhtlg

SCOPe Domain Coordinates for d6h6ub_ are not available.

Timeline for d6h6ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6h6ua_, d6h6uc_, d6h6ud_, d6h6ue_, d6h6uf_