![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (18 species) not a true protein |
![]() | Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries) |
![]() | Domain d6flob1: 6flo B:219-354 [372828] automated match to d4jv4a1 complexed with gol, nos |
PDB Entry: 6flo (more details), 2.14 Å
SCOPe Domain Sequences for d6flob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6flob1 b.82.3.0 (B:219-354) automated matches {Trypanosoma brucei [TaxId: 185431]} yvapyfeksedetalilklltynvlfsfldsrdlmtvagamwrvefkqddcimeagqttc dklyiiqdgkadiikegqkvylkvegtavgelelmyqtptvatvkvctpeliawaldrdt yrhlvmgsairrrety
Timeline for d6flob1: