Lineage for d6flob1 (6flo B:219-354)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2817013Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries)
  8. 2817016Domain d6flob1: 6flo B:219-354 [372828]
    automated match to d4jv4a1
    complexed with gol, nos

Details for d6flob1

PDB Entry: 6flo (more details), 2.14 Å

PDB Description: regulatory subunit of a camp-independent protein kinase a from trypanosoma brucei at 2.1 angstrom resolution
PDB Compounds: (B:) Protein kinase A regulatory subunit

SCOPe Domain Sequences for d6flob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flob1 b.82.3.0 (B:219-354) automated matches {Trypanosoma brucei [TaxId: 185431]}
yvapyfeksedetalilklltynvlfsfldsrdlmtvagamwrvefkqddcimeagqttc
dklyiiqdgkadiikegqkvylkvegtavgelelmyqtptvatvkvctpeliawaldrdt
yrhlvmgsairrrety

SCOPe Domain Coordinates for d6flob1:

Click to download the PDB-style file with coordinates for d6flob1.
(The format of our PDB-style files is described here.)

Timeline for d6flob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6flob2