SCOPe 2.08: Domain d6edma1: 6edm A:3-252

Lineage for d6edma1 (6edm A:3-252)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Clostridioides difficile [TaxId:1496] [372824] (9 PDB entries)

8. Domain d6edma1: 6edm A:3-252 [372825]
   Other proteins in same PDB: d6edma2
   automated match to d3isga_
   complexed with so4

Details for d6edma1

PDB Entry: 6edm, 1.4 Å

PDB Description: structure of apo-cdd-1 beta-lactamase

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6edma1:

Sequence; same for both SEQRES and ATOM records:

>d6edma1 e.3.1.0 (A:3-252) automated matches {Clostridioides difficile [TaxId: 1496]}
vnivdysdcfegisggaifcntknkeyniynkelietrrspcstfkivstliglekgvin
skesvmgydgtdypnknwnknlsleeafkescvwyykklinkvdaksvqnilddlkygnc
disewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdimai
dvndaninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvkei
ainiikkyys

Timeline for d6edma1:

• d6edma1 first appeared in SCOPe 2.07