Lineage for d6ecjd_ (6ecj D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2304027Species Human (Homo sapiens) [TaxId:9606] [109644] (12 PDB entries)
    Uniprot P99999
  8. 3072758Domain d6ecjd_: 6ecj D: [372820]
    automated match to d3nwva_
    complexed with hem

Details for d6ecjd_

PDB Entry: 6ecj (more details), 2.7 Å

PDB Description: human cytochrome c g41t
PDB Compounds: (D:) cytochrome c

SCOPe Domain Sequences for d6ecjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ecjd_ a.3.1.1 (D:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrkttqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d6ecjd_:

Click to download the PDB-style file with coordinates for d6ecjd_.
(The format of our PDB-style files is described here.)

Timeline for d6ecjd_: