Lineage for d1bsra_ (1bsr A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29958Protein Seminal ribonucleasease [54086] (1 species)
  7. 29959Species Cow (Bos taurus) [TaxId:9913] [54087] (3 PDB entries)
  8. 29962Domain d1bsra_: 1bsr A: [37280]

Details for d1bsra_

PDB Entry: 1bsr (more details), 1.9 Å

PDB Description: bovine seminal ribonuclease structure at 1.9 angstroms resolution

SCOP Domain Sequences for d1bsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsra_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus)}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOP Domain Coordinates for d1bsra_:

Click to download the PDB-style file with coordinates for d1bsra_.
(The format of our PDB-style files is described here.)

Timeline for d1bsra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bsrb_