Lineage for d1bsra_ (1bsr A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. Protein Seminal ribonucleasease [54086] (1 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
    Uniprot P00669 27-150
  8. Domain d1bsra_: 1bsr A: [37280]
    complexed with so4

Details for d1bsra_

PDB Entry: 1bsr (more details), 1.9 Å

PDB Description: bovine seminal ribonuclease structure at 1.9 angstroms resolution
PDB Compounds: (A:) bovine seminal ribonuclease

SCOPe Domain Sequences for d1bsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsra_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOPe Domain Coordinates for d1bsra_ are not available.

Timeline for d1bsra_:

Domains from other chains:
(mouse over for more information)
d1bsrb_